FOXO4-DRI (10 mg)
Original price was: $80.00.$60.00Current price is: $60.00.
FOXO4-DRI is a synthetic peptide designed to selectively induce apoptosis in senescent cells, which are cells that have stopped dividing but remain metabolically active. These cells contribute to aging and various age-related diseases through their pro-inflammatory secretions, known as the senescence-associated secretory phenotype (SASP).
FOXO4-DRI Peptide Description
FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.
Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids) |
| Molecular Formula | C228H388N86O64 |
| Molecular Weight | 5358 g/mol |
| CAS Number | 2460055-10-9 |
| Synonyms | Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431 |
FOXO4-D-Retro-Inverso Structure
” alt=”FOXO4 Structure | FOXO4-DRI (10 mg)” width=”201″ height=”241″ data-opt-id=”959000664″ data-opt-src=”https://www.peptidesciences.com/media/wysiwyg/FOXO4_Structure.png” />
Source: Uniprot
Related products
L-Carnitine (600mg/mL)
L-Carnitine is a naturally occurring compound involved in fatty acid metabolism. It functions as a transporter of long-chain fatty acids into the mitochondria, enabling β-oxidation for energy production. This metabolic pathway supports cellular energy balance and reduces the risk of toxic fatty acid buildup within cells.
Note: Each vial is reconstituted with 20ML of BAC water.
NAD+ Peptide (500mg)
Oxytocin (10mg)
PNC-27 (10mg)
PT 141 Peptide (5mg)
