Cagrilintide (Amylin Analog) (5mg)
$170.00
Cagrilintide is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Cagrilintide Description
Cagrilintide is a novel long-acting amylin analog featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409 g/mol |
| CAS Number | 1415456-99-3 |
| PubChem CID | 171397054 |
| Synonyms | 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N |
Cagrilintide Peptide Structure
Source: PubChem
Lyophilized Peptides:
Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.
Related products
ARA 290 Peptide (15mg)
DSIP (Delta Sleep Inducing Peptide) (5mg)
Delta Sleep Inducing Peptide (DSIP) is a naturally occurring nonapeptide known for its role in promoting sleep, particularly delta sleep, across various species including rabbits, rats, and mice. It is characterized by its ability to enhance delta and spindle electroencephalogram (EEG) patterns, which are associated with deep sleep stages.
Follistatin (FLGR242) (10mg)
Kisspeptin-10 (10mg)
L-Carnitine (600mg/mL)
L-Carnitine is a naturally occurring compound involved in fatty acid metabolism. It functions as a transporter of long-chain fatty acids into the mitochondria, enabling β-oxidation for energy production. This metabolic pathway supports cellular energy balance and reduces the risk of toxic fatty acid buildup within cells.
Note: Each vial is reconstituted with 20ML of BAC water.
NAD+ Peptide (500mg)
