Cagrilintide (Amylin Analog) (5mg)
$170.00
Cagrilintide is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Cagrilintide Description
Cagrilintide is a novel long-acting amylin analog featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409 g/mol |
| CAS Number | 1415456-99-3 |
| PubChem CID | 171397054 |
| Synonyms | 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N |
Cagrilintide Peptide Structure
Source: PubChem
Lyophilized Peptides:
Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.
Related products
Cell Factors™
Cell Factors™ is a purified blend of natural signaling messengers derived from early placental cells, designed to support healthy cellular communication and environmental balance.
By helping cells “talk” to each other more effectively, it allows researchers to study how cellular signaling influences repair, regeneration, and overall function.
CJC 1295 Ipamorelin (10mg)
Follistatin (FLGR242) (10mg)
Kisspeptin-10 (10mg)
L-Carnitine (600mg/mL)
L-Carnitine is a naturally occurring compound involved in fatty acid metabolism. It functions as a transporter of long-chain fatty acids into the mitochondria, enabling β-oxidation for energy production. This metabolic pathway supports cellular energy balance and reduces the risk of toxic fatty acid buildup within cells.
Note: Each vial is reconstituted with 20ML of BAC water.
